SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000020399 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000020399
Domain Number 1 Region: 687-868
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-62
Family SPRY domain 0.0000047
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-21
Family Pyrin domain, PYD 0.0037
Further Details:      
 
Domain Number 3 Region: 459-524
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000733
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000020399   Gene: ENSDNOG00000044936   Transcript: ENSDNOT00000047257
Sequence length 874
Comment pep:known_by_projection scaffold:Dasnov3.0:JH574837.1:278770:291013:1 gene:ENSDNOG00000044936 transcript:ENSDNOT00000047257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLGDHLLHSLEELVPYDLEKFKFKLQNTSREKEQTRIPRGLLQMAGPVEMASLLLNH
YGEEDALRLTLQILRAINQRLLAEELHRATGQKCPLQEGTTESSAMSCSSGENKPKSLKT
SEGPESYGQRESGDGAASPLTSQPEVERGAQKKCPGKRRDEKGSEGLDMQSKHGTRGMGQ
SPKRSPFLSPGRVPWEKGKESPRLRRNASSASRLHDLSSRSFSGSLGRKDFKTSETSRKR
RPKSLEFPIYPGEKGPPNSEVLLSQEGTRTADPNSTATPSKVATLEVEITVLPEQGSRNP
ENSATPEGGAFRKTLSNTSLTGEKTRKHPESTAPLEENGIGSPEAPVTLGEMVDSTLHET
SNPQVVLSSEKKGPQNPDELASLGKAACEGRPPDKAVCSLCQAQEGDGVGGTCVHGSCCC
SVASGDAGGHSPSCPQGQAPLPEKCPKEPEQPKSPQLHSLSPEPPPQCDRHMKQLRLLFC
EDHREPVCLICSLSQEHRGHQVRPIEEAALECKEQIQRQLEHLKELKKYGEEQKSEGEKE
TANFLKQIDTQRQKVQGQLEELGRFLEQQEQRFMAWLQKLGQAVGQVQGAYDSRVSRDVA
VLDELIVGLEAKQCQPAWTLIQDIGDTLHRAKTVTVPEPWATPPEVKEKIHLLFRKSEFV
EKSMKHFSESLRLEIESFHVPELPGAQAHAVNVILDVETAHPNLIISKDLKSVKLGNKWD
RLPDGPERFDSCIMALGSPAFLSGCQYWEVEVGDKTAWILGVCEASICKKGSMALTPENG
YWVVMMTRRNDYHASTFPPTHLRMREPPKRVGIFLNCEAGDISFYNVTAKSHIYTFTCSS
SSGPLQPIFSPGAHDGGKNSDPLIICPVGGQGPC
Download sequence
Identical sequences ENSDNOP00000020399 XP_004475910.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]