SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021408 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021408
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-34
Family SCAN domain 0.00015
Further Details:      
 
Domain Number 2 Region: 228-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 756-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.89e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 673-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-16
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 830-881
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-16
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 7 Region: 973-1023
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000145
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 859-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000657
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 591-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000112
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000126
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 11 Region: 460-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000196
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021408   Gene: ENSDNOG00000041040   Transcript: ENSDNOT00000050289
Sequence length 1026
Comment pep:novel scaffold:Dasnov3.0:JH575651.1:18833:58643:-1 gene:ENSDNOG00000041040 transcript:ENSDNOT00000050289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRCSAVHPRPRARTSKERGRLKIVKKEEEERFTSVQTARPQRLNRPGQELFRQLFRQ
LRYHESSGPLDTLSRLRELCRWWLRPDVLTKKQILELLVLEQFLSILPWELRTWVQLHHP
ESGDEAVGLLEELQKDLSGTPRKDPVPAQGPAVHWMGTGALRDTQIWPPALLLQSSPDLG
DHLEPPCGTGVRDFLAEPSGPSAAQVPDLDPREGCPGDQVVAAGPLTVQPQEALTFKDVE
VTFTQDEWGWLDYGRRNLYRDVMLENYRNVVSLVGLFPKPALISWLESREPWGLNVQETQ
PAENPDAAPAGGELQIKADKILKHEPLEEAETLAVSSGCPALSVSEETGTRETSRQDCNL
KGHWGDLTGESIKQKEANFSYVTGKESQEPGGCNSRDVKQVTYLRIPGRRRSLKRGYGRH
FRLNSHHFDSKEYGKGLRHMNGGVSLYQRIHVGLKGNEKDSCGKDFSLSSQHQQGQSLHA
VETPYKCSDCGRTFSLSSHLACHQRLHTQEKPFTCRVCGKAFRWSSNCVRHEKIHTGVKP
YKCSLCEKSFGRLSAYRLHQETHTKQKCVESTQYGEPFTCGSGLGHHLRGHSGEKPFDCS
QCRKSFHCKSYVLEHRIHTQEKPFKCTKCRKTFRWRSNFTRHRRQHQLYEQDKCRNELRQ
AGCGQPPKAAPVEKTFLCQQCGKTFTRKKSLLDHQRLHTGEKPYQCSDCGKEFAYRSGFM
VHKKKHALKRKSEAGLPFSQDRGFPAPQSSDPAEEPYRCGQCGRDFRNRSFLLIHQRVHT
RERPYECRECGKAFRWSSNLSRHQRIHSLGKHYKYRECEKTPGLQSKILTGEKPFWCQEC
GKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHTKEKPFKCQWCGKDF
IGRHTLCVHQRKHSRAAQSKSSPSGLFSCQDPEVSLREARPSQEKPLEDCGDTYNQSSRL
ASLQNKPIGISCHKCNLCGKTFKKSSQLISHKRFHTRERPFKCMECGKTFRWSSNLARHM
KNHIRE
Download sequence
Identical sequences ENSDNOP00000021408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]