SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021474 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021474
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 248-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.58e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 444-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-16
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 5 Region: 168-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000867
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 300-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000228
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 38-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000942
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021474   Gene: ENSDNOG00000033105   Transcript: ENSDNOT00000048947
Sequence length 497
Comment pep:novel scaffold:Dasnov3.0:JH581932.1:104261:118825:-1 gene:ENSDNOG00000033105 transcript:ENSDNOT00000048947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPCVSLLAPPAPQGLARPQDGAPGCQVLTAPLEMLEAQDSVTLDNVTLYLTKKEWLRP
GPEQRTLEYYGNVTSVGVPVLNPALVSHLAPGQVLLVSEPSLHVDRAEHSESMAVRQKTV
GEAAPPLEVASASSPRAADPGPEVRQNAGSAGSAGRSGSPPNLPVEHHFACKECGDTFRL
KVLLVQHQRIHSEEKGWECHDCGQVFRGVSAFNEHRKVHVTVEPRPGPSRALEDAAVAKR
EQVEREAKPFECEECGKRFKKNAGLSQHLRVHSRDKPFQCEECGRSFKVTTHLLRHQKLH
AAEKPFACKACSRGFLDRQELLKHQRVHSGPLPFDHDDCSPSFWGVIGLAEPQRLHGGAK
PYGCPHCGKLFRRSSELTKHRRVHTGEKPYECGQCGKAFRQSSSLLEHQRIHTGERPYEC
GDCSKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSSGLSRHRRTHGGARRCECSECG
RVFKRRSALQKHQPTHE
Download sequence
Identical sequences XP_004482635.1.11602 ENSDNOP00000021474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]