SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021833 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021833
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-76
Family BAR domain 0.0000000578
Further Details:      
 
Domain Number 2 Region: 283-344
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021833   Gene: ENSDNOG00000049173   Transcript: ENSDNOT00000030865
Sequence length 347
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570731.1:2757724:2942378:1 gene:ENSDNOG00000049173 transcript:ENSDNOT00000030865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMAGLKKQFHKASQLFSEKISGVEGTKLDEEFQDMERKIDVTNKAIAEIISKSTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLADCMLKYGKELGDDSAFGNALIDVGES
LKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKRKRVGKIPD
EEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVLIEAALDYHRQTAEILQELQGKL
RARILSASKLARREYKPRPIQRSSSEHNGIATTSSTKTAGTKVPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIRGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences XP_004472141.1.11602 ENSDNOP00000021833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]