SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022810 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000022810
Domain Number 1 Region: 576-703
Classification Level Classification E-value
Superfamily TNF-like 2.49e-43
Family TNF-like 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022810   Gene: ENSDNOG00000043920   Transcript: ENSDNOT00000031899
Sequence length 704
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570810.1:1431703:1434430:-1 gene:ENSDNOG00000043920 transcript:ENSDNOT00000031899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAPTPLFPPPPPLLLLLLLGSGLRAASGGGAGGGAGYAPVKHVQPMQKGPVGPPFREG
KGQHLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGTGKPGLHGQPGPAGPPGF
SRMGKAGPPGLPGKTGPPGQPGPQGEPGIRGDQGLRGPPGTPGLPGPSGIAVPGKPGPQG
VPGPPGFRGEPGTHGEPGPPGDRGLKGDNGVGQPGLPGPPGQGGAPGPPGLPGPAGMGKP
GLDGLPGAPGDKGESGAPGVPGPSGEPGAVGPRGPPGVGGMGVPGTAGVPGPQGPAGAKG
EPGARGTPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGP
PGLPGSAGLPGRRGPPGPKGETGPGGAPGVPGIRGDQGPSGLAGKPGLPGERGLPGAHGP
PGPTGPKGEPGFAGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGL
PGLKGETGLPGPPGEGKVGEPGLAGPTGPPGVPGSPGLTGPPGPPGPPGPPGAPGAFDET
GIAGLHLPNGGVEGAVLGKGGKPLFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLY
NGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQA
SGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
Download sequence
Identical sequences ENSDNOP00000022810 XP_004472303.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]