SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023775 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023775
Domain Number 1 Region: 514-772
Classification Level Classification E-value
Superfamily NHL repeat 1.7e-46
Family NHL repeat 0.000009
Further Details:      
 
Domain Number 2 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 3.6e-24
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 46-121
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000236
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 4 Region: 137-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000717
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023775   Gene: ENSDNOG00000043326   Transcript: ENSDNOT00000032940
Sequence length 774
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569651.1:937563:954305:-1 gene:ENSDNOG00000043326 transcript:ENSDNOT00000032940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGRNKKLGPDRQRRLRRGSQVEEEPSVGIMAKREDSPGPEVQPMDKQFLVCSICLDRYR
CPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQ
QAPDGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEACETAMCGECRAGEHREHGTVL
LRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ
ALQQRKQALVSDLEAICGAKQKVLQTQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLV
RKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGE
GLRQALVGQPASLTVTTKDKDGRLVRTGSAELRAEITGPDGTRLSVPVVDHKNGTYELVY
TARAEGELLLSVLLYGQPVRGSPFRVRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAV
RRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCI
QVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKI
GAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGN
SRIQVFDSAGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences ENSDNOP00000023775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]