SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024879 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024879
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Immunoglobulin 7.88e-19
Family I set domains 0.0019
Further Details:      
 
Domain Number 2 Region: 292-385
Classification Level Classification E-value
Superfamily Immunoglobulin 6.26e-17
Family I set domains 0.003
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000024879
Domain Number - Region: 403-425
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0873
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024879   Gene: ENSDNOG00000035621   Transcript: ENSDNOT00000036426
Sequence length 425
Comment pep:novel scaffold:Dasnov3.0:JH569025.1:145890:165017:-1 gene:ENSDNOG00000035621 transcript:ENSDNOT00000036426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLPRPSISAEPGPVVHPGSSVTFVCRGPPGVDTYRLEKEEGTAVDKEPLLGETEARFPIA
RASEDTAGPYRCVYYKGLRWSEFSGPLELQVTDEDTTQGLHPSATMSTFPTPMPPFLCGH
WIGCVHCTSMSRGGSDSTWILDAIFLLSVVGTLGSMKGLPDMAPQRRNTSLCVFYFPTAC
HTWVLPLGNLKIIINKTYPKPSIWAATGPIFPRGPCDPLVPGPLQADVHQLYEVRVSEPW
DTQAPVDFRDKVRFPITYTSTRRAGEQRVHNGLEGSSEPSHPLCLVVTGSTRKPSLSAHP
SPGAACGGNVSLSCSAQNPTGTFNLLKETPPAQCLDLAVLCWGAPSLFWGPVTASHGGTY
RCHGCPSSYPDRWSLPRDPLDIEITAVFHSPGLCQVCPLGAGAPGDTVTLQCHSEAGFDR
FALTK
Download sequence
Identical sequences ENSDNOP00000024879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]