SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025202 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025202
Domain Number 1 Region: 60-200
Classification Level Classification E-value
Superfamily TNF-like 3.16e-24
Family TNF-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025202   Gene: ENSDNOG00000037063   Transcript: ENSDNOT00000044011
Sequence length 202
Comment pep:known_by_projection scaffold:Dasnov3.0:JH561987.1:266908:270008:1 gene:ENSDNOG00000037063 transcript:ENSDNOT00000044011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGWPNSVMAEEGSGCAVPRLAWASLLRSVLLPLLAGAVGAVVIYSILCSQRLPQTQQLE
SPGWDIAELQLNHTGSRQDPRLRWEGSPALGRSFLHGPELDHGQLRVQRAGVYRLHIQVT
LANCSSRRMGAHRPAALTVGVCSPAARSVSLLRLSFHRGCTVASQRLTPLARGDVLCANL
TLPLLPSRNSDETFFGVHWVHP
Download sequence
Identical sequences XP_004447667.1.11602 ENSDNOP00000025202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]