SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025270 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025270
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily TNF-like 1.58e-37
Family TNF-like 0.000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025270   Gene: ENSDNOG00000038849   Transcript: ENSDNOT00000030571
Sequence length 261
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567531.1:439078:451948:1 gene:ENSDNOG00000038849 transcript:ENSDNOT00000030571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIETYSQTSPRSVTSGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKRIQKCNKGEGSLSLLNCEEIRSQFEAFVKDIMLNEEGKKKEQHFEMQRGDQDP
QIAAHVVSDASSKTGSVLQWAKKGYYTMSNNLVTLKNGKQLVIQREGLYYVYTQVTFCSN
RETLGQTPFIASLCLRSTSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQSGASVFVN
VTDPSQVNHGTGFTSFGLLKL
Download sequence
Identical sequences A0A0U5JY63
ENSDNOP00000025270 XP_004457559.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]