SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025352 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025352
Domain Number 1 Region: 191-287
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 1295-1389
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 73-178
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 1565-1647
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-17
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 1745-1838
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 1107-1207
Classification Level Classification E-value
Superfamily Immunoglobulin 6.49e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 924-1019
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000123
Family I set domains 0.033
Further Details:      
 
Domain Number 8 Region: 858-932
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000894
Family I set domains 0.027
Further Details:      
 
Domain Number 9 Region: 744-836
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000103
Family I set domains 0.021
Further Details:      
 
Domain Number 10 Region: 1666-1752
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000129
Family I set domains 0.0036
Further Details:      
 
Domain Number 11 Region: 1394-1479
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000511
Family I set domains 0.013
Further Details:      
 
Domain Number 12 Region: 1015-1101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000621
Family I set domains 0.028
Further Details:      
 
Domain Number 13 Region: 1203-1287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000344
Family I set domains 0.024
Further Details:      
 
Domain Number 14 Region: 652-746
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000748
Family I set domains 0.0094
Further Details:      
 
Domain Number 15 Region: 460-549
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000388
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 16 Region: 1487-1572
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000954
Family I set domains 0.0047
Further Details:      
 
Domain Number 17 Region: 378-486
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000935
Family I set domains 0.0053
Further Details:      
 
Domain Number 18 Region: 12-55
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000908
Family I set domains 0.06
Further Details:      
 
Domain Number 19 Region: 316-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000102
Family I set domains 0.05
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000025352
Domain Number - Region: 563-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000906
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025352   Gene: ENSDNOG00000035117   Transcript: ENSDNOT00000049909
Sequence length 1840
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578554.1:97641:115783:-1 gene:ENSDNOG00000035117 transcript:ENSDNOT00000049909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRLSFPADGAEHGLLLSAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAPEPEPPAPE
RPLPPPGAGEGVPVFLTGPGSQWVLRGAEVVLTCLVGGLPEPALYWEKDGLPLDEVWDSS
HFALVPGRAEGGPGVSLALRILAARLPDSGVYVCHARNPHGHAQAGALLQVHRPPESPPE
DPDEAPESVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLLY
RDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKVKPFPRFKEEEAEGEEIC
ISMVNHQQYLRALGATAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGVYLCEMR
GRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETREPGVEGCWSRDGEDLPATCQSS
SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHNPPGPPVLVEMFKGHKNTVL
LTWKPPEPVPETPFIYRLERQEVGSDDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRVCTV
SEHGRSPHVVFHGSAHLVPTARLVVGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGKELK
SDEPEGQVEPGALCYRIEQKGLQHRLVLQAVRHQDSGALVGFSCPGVQDSAALTIQESPV
HILSPQDRVSAAFTTSEQVVLTCELSRVDFPASWYKDGQKVTESESLVVKADGRKHHLIL
PAAQARDSGEFECRTEGVSAFFSITVRDPLVHILDPEHVFVHAITSECVMLSCELDREDA
PVHWYKDGQEVEGSNSAVLESDGPHRRLVLPAAQPRDGGEFQCVAGEERAFFTVTITDVS
SWIVCPSGKVYVAAVCLERVVLTCELCRPWAEVRWTKDGEELAESPALLLQKEDSVRRLV
LPAVQLKDSGEYLCEIADESASFTVTVTEPPVRILSPRDEVTLVAVSLECVVLMCELSRE
DAPVCWYKDGLEVEESEALVLESDGPRRRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTA
PPERIVHPAARSLDLQFRAPERVELRCKVAPAGARVRWFKDGLEVEASDTLQLGAEGAAR
TLALPHAQPKDTGEYVCETRDEAVTFNVSVAEPPVRFLAPEAAPSPIRVAPGEPVVLSCE
LSRASAPVLWSHNGRPVQEGEGLELQAEGPRRVLRIWAASAAHAGLYTCQSGEALGAPSL
SFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQ
LEQAGARQVLRVRGARSRDAGEYLCDAPQDSRIFLVSVEEPPPVKLVSELTPLTVHEGDA
ATFRCEVSPPDADVTWLRNGAAVSPGPQVEIAQNGSSHTLTVRSCQLQDAGTVTARAGGT
ATSARLHVREAELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGEPLPGDSRL
CVAQDGHTYRLVIHSVVLADQGIYGCESRHDRTLARLSVRPKQLRALRPLEDVTVGEGGS
ATFQLELSQEGVAGEWARGGVRLQPGPTCHIHAEGRTHRLALSGLGRTDGGCVSFTADSL
RCAARLTVREAPVTIVRGPQDLEVTEGDTATFECELSQALADVTWEKDGRVLAPSPQVRL
QALGTRRLLQLRHCDPSDAGAYSCAVGAARAGPVRLAVRERVVSVLSELRSVRAREGDGA
TFQCTVSEAEATGSWQLGGRPLRPEGRVRIRQEGKKHVLVLSELRAEDAGEVRFQAGPAQ
SAAQLEVEALPLQMCRRPPREKTVLIGRRAVLEVTVSRSGGHVCWMREGVELCPGDKYEL
RSHGPTHSLVIHDVRPEDQGNYCCQAGQESSHTRLLVEGS
Download sequence
Identical sequences ENSDNOP00000025352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]