SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025511 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025511
Domain Number 1 Region: 112-205
Classification Level Classification E-value
Superfamily Virus ectodomain 3.91e-24
Family Virus ectodomain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025511   Gene: ENSDNOG00000040136   Transcript: ENSDNOT00000050935
Sequence length 278
Comment pep:novel scaffold:Dasnov3.0:AAGV03163517.1:14914:15761:-1 gene:ENSDNOG00000040136 transcript:ENSDNOT00000050935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFTHISSKGLCIHPRSSHTPSLTACTNYTSPNISAKYLVPLNTTQWLCSSTGLTPCLSV
ATLNKTKETCALILLTPRVIYHTPLHFFEAFDHTQEAIYLHKREPITAVLTVTSLLATAG
AATGVAALATQASALQNLRQAVDSDINAVKYLKDSLNSLSEVVLQNRRGLDLLLLKEGGL
CAALGEECCVYANYTGLVDSSLKELEKGLNQRRLELLVPGASCSPSSPISSLITPVLLII
LGLTVGPWAIRRIIRLAKDHADSVFSSFVQIHYHRLAT
Download sequence
Identical sequences ENSDNOP00000025511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]