SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026999 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000026999
Domain Number 1 Region: 39-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000404
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 657-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000339
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 428-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000744
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 475-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000313
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 565-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000118
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 720-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000357
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 7 Region: 521-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000828
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000026999
Domain Number - Region: 96-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00404
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026999   Gene: ENSDNOG00000043512   Transcript: ENSDNOT00000039727
Sequence length 847
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569290.1:373559:382279:1 gene:ENSDNOG00000043512 transcript:ENSDNOT00000039727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVVRGGQPVPSQAPLCFDPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKA
HSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIW
NHMDRPLSIPKPGPVSRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRP
VPVSRPVPVSRPVPVTKPVPVSRPVPVTKPVPVTKPLPVSKPVPITKLVTVTKPVPVSKP
VPVSRPVAVSKPVTVSRPVAISRPPPCKMVLLTKSENKSPRAVGRSSGKKRATDSLDTCP
IPPKQARPENGAPGSSTVGQSSGVQRSVDLPGGGLSPGSRASGGREVPWAAGPLSPPEED
PERTKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARAHRAKRQEATGPEDSWNKSA
ARPLHGRQGGGPEEPWLRALHERGEAVCPTCSVVTRKTLVGLKKHMEVCQQLQDALKCQH
CRKQFKSKAGLNYHTMAEHSAKPSDAEASEGGEQEERDRLRKVLKQMGKLRCPQEGCGAA
FSSLMGYQYHQRRCGKPPCELDSPSFPCVHCGKNYRSKAGHDYHVRSEHSAPPPEEPVDK
PPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNY
TRPGLPTLSPQLLEAWKSQVKEKGHVSCPNDCCEAIYSSVSGLKAHLASCSKGDHLVGKY
HCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPRHRSQDSLAPKKEERKSPGGGRKR
GRKPKERLAVEPKLPPRRDDWPLAGRDKGGRGPTSRKIYLWPTPSLSSWERERARCLHTE
CGADSKD
Download sequence
Identical sequences ENSDNOP00000026999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]