SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027168 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027168
Domain Number 1 Region: 136-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-55
Family SPRY domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 49-124
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000959
Family RING finger domain, C3HC4 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027168   Gene: ENSDNOG00000045556   Transcript: ENSDNOT00000034502
Sequence length 317
Comment pep:novel scaffold:Dasnov3.0:JH564648.1:767069:770698:-1 gene:ENSDNOG00000045556 transcript:ENSDNOT00000034502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGEAGCEGGGRRDPVYKSPWLMDLKSDLSCQWKELEAGGEPTGGETLTMAEHFKTATTCP
FCMAYLEKPMSLKCGYVCCAHCIGSLKQEQFGGVWLCPFCSAVSQKNDIRPKRQLESLVS
KIKELEPHLRGSLQMNPRMLKFQVDVTLDVSTANNHLIVFDDLRSVQYGYLEQNREEGAK
RFKAVCVLGSSRFTSGRHYWEVDVGTSREWSLGVCKESVDRQEEILSSERGFWTVGLRNG
ERYSASTTPSTPLLVNPRLHRVGVFLDMALGNISFCDIRDRSHIFTFTHISPKEPLLPFF
APANIVNDGQGFLRIGP
Download sequence
Identical sequences ENSDNOP00000027168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]