SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000028543 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000028543
Domain Number 1 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 44-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-19
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 5 Region: 278-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 432-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 161-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000416
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000028543   Gene: ENSDNOG00000000486   Transcript: ENSDNOT00000000486
Sequence length 533
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570292.1:101027:105970:-1 gene:ENSDNOG00000000486 transcript:ENSDNOT00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLGPAGSPASQAGLERRCPGLRSSPPRAPRRLRTAAALMDPALXHVTFEDVFVYFSQDEW
GLLDDAQKLLYRHVMLKNFALIASLGMTSSSPHIVTQLGQREESWVPDQVEMSLATAGAV
QRGPGPGYWHGMEDEETSSEQNVLLGVSRARTPSAGPCIPKFHPYGMCGSTLKGIVPLTQ
YEGIKARQKLYMCGVCGKQFRLIANLHQHQKQHSREKTIQKYEGVDSVKTCMIYTPEKTY
IYRGNGMDFPTTSNFLQQQLPPNGMKSHKNTEHMGTFHTGQKHHKCPECGESFSRKDTLV
RHQRIHTGERPYECSECGKSFSQSSDLFKHQTVHTGEKPYECTECGKFFRQISSLIEHRR
VHTGERLYKCSECGKFFSSKSNLIRHQEVHTGARPYVCGECGKEFNRRHTLVLHQRIHTG
EKPYKCSECGKSFSQSSHLIVHWRIHSNDYECTRCGKAFNCISKLTQHQKVHSGEKPYEC
SKCGKAFTQRPNLIRHWKIHTGERPYVCSICGKEFNRKHTLVLHQRIHIGEKP
Download sequence
Identical sequences ENSDNOP00000028543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]