SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000029074 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000029074
Domain Number 1 Region: 632-816
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-36
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 10-101
Classification Level Classification E-value
Superfamily RING/U-box 1.35e-30
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 335-420
Classification Level Classification E-value
Superfamily RING/U-box 1.44e-24
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 4 Region: 99-163
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-18
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 425-488
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.28e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000029074   Gene: ENSDNOG00000038027   Transcript: ENSDNOT00000042226
Sequence length 819
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570452.1:30423:96842:-1 gene:ENSDNOG00000038027 transcript:ENSDNOT00000042226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSGRSQKITAMTSAVLVDIRDEVTCPICLDLLMEPLSIDCGHSFCQACITGNSKQSQIS
QEGESSCPVCRTSYQPDNLRPNRHLANIVERLREVVLGPGRQSKLILCAQHGEKLQLFCK
EDGKVICWLCERSQEHRGHHTFLMEEVAQEYQEKFQKSLKKLRKEQQDTENLQAVIREKK
TSWKNQMEPERHRIQSQFNQLRSILDKEEQRELKKLEKEERKGLNIIEEAEDELVQQSQS
LRELISDLEHRCQGSTMELLQDVSDVTTRSEFWTLKKPKALPSKLRSAFRVPDLKKMLRV
FRELTDVQSYWVWGRDSLERSKRPSEVRTARSREAATMASEILVDIKEEVTCPICLDFMT
EPLSIDCGHSFCQACITGNSKQSQISQEGESSCPCRTSYQHENLRPNRHLANTVEKFREV
ELGPGKQPKLILCAQHGEKLQLFCKEDGNVICWLCERSQEHRGHHTFLLEEVAKKYQEKL
QAVLKRLRTDQEAETLETDIKKERALWKRQIQNGRKHIQAEFKKLRDVLNSEEQRELQKL
KREEGKVLDTLAKTENNLIKQSQLLRELISDMEHHLQGSSVEMLQSLNGIFHKAEIFHLK
KPTYGFPCQFSPSVSIHFLKVSLDFFRDTKNVQCYWVHMTLNPVMTNSNIVISEDWRQVR
SSASLNLPRTRSYVCDILGFHMITSGKHYWEVDVSQKSSWFLGTPFPEFGSSAHFHNDYS
RYQPRCGYWVVGLQNEYNYNAFVDSSSSDPSILTLFLTVRPCRVGVFVDYESRIVSFFNV
TNCGILIYKFSNYVFSGTVFLYFNPTSCRGPMSLCSPSS
Download sequence
Identical sequences ENSDNOP00000029074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]