SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000029874 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000029874
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000000288
Family alpha-catenin/vinculin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000029874   Gene: ENSDNOG00000043245   Transcript: ENSDNOT00000039642
Sequence length 161
Comment pep:novel scaffold:Dasnov3.0:JH570374.1:4465864:4493746:-1 gene:ENSDNOG00000043245 transcript:ENSDNOT00000039642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTNDLKSPNQRDEIAGARALLKEHSPLLHSICSAYLEHSDVASLKASKDTVCEEIQNALN
VISNASQGIQNMPDPPEPQAATLGSALDELENSVVLDPLTVTEKEIRPTLERRLEAIISG
AALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNDT
Download sequence
Identical sequences ENSDNOP00000029874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]