SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030753 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030753
Domain Number 1 Region: 75-355
Classification Level Classification E-value
Superfamily L domain-like 5.19e-50
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 414-482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000662
Family Fibronectin type III 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000030753
Domain Number - Region: 31-71
Classification Level Classification E-value
Superfamily L domain-like 0.00986
Family Ngr ectodomain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030753   Gene: ENSDNOG00000043104   Transcript: ENSDNOT00000036417
Sequence length 650
Comment pep:known_by_projection scaffold:Dasnov3.0:JH574228.1:1423419:1437568:-1 gene:ENSDNOG00000043104 transcript:ENSDNOT00000036417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGPAWSVFLIGTKIGLFFQVAPLLVMAKSCPSACRCDAGFIYCNDRFLTSIPAGIPEDA
TTLYLQNNQINNAGIPSDLRNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHFSTIPWGLPKTIEEL
RLDDNRISTISSPSLQDLTSLKRLVLDGNLLNNQGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQENHINRMPPNAFSSLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPAKVNVRGLMCQAPEKVRGMAIKDLSVELFDCKDSGV
IHNSQITTVLPNTVNPPAQGQWPAPVTKPPDIKNPKLTKKQRTTGSPARKTITITVKSVT
SETIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGDRSEYLVTALEPDSPYRVCM
VPMETSNLYLFDESPVCIETETAPLRMYNPTTTLNREQEKEPYKNPSLPLAAIIGGAVAL
VAIALLALVCWYVHRNGALFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPI
SNEPISKEEFVIHTIYPPNGMNLCKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences ENSDNOP00000030753 XP_004475338.1.11602 XP_004475339.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]