SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031683 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031683
Domain Number 1 Region: 35-133
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000556
Family Virus ectodomain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031683   Gene: ENSDNOG00000042379   Transcript: ENSDNOT00000050112
Sequence length 208
Comment pep:novel scaffold:Dasnov3.0:JH570080.1:344883:346212:1 gene:ENSDNOG00000042379 transcript:ENSDNOT00000050112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPPDSSNQSFDCNITHCVLSNCWDHTKHLYAIIVRIPSLIWIPVNVTEWTGPSELITHLH
FRQKRAVGVVVALIAAIIASLATAATSITSIVQSNSNANTINNLVEKMATPLQTQNLLNN
HIHGVLHNVQQQIDLLEEEVQMIMQLTRLPCDINYPHICVTPISATDGMANFTAAKAMSK
QTLLRHWNNDFLNLTTQLTHQILTLNST
Download sequence
Identical sequences ENSDNOP00000031683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]