SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032334 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032334
Domain Number 1 Region: 91-236
Classification Level Classification E-value
Superfamily SET domain 5.23e-31
Family Viral histone H3 Lysine 27 Methyltransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032334   Gene: ENSDNOG00000046058   Transcript: ENSDNOT00000041182
Sequence length 461
Comment pep:known_by_projection scaffold:Dasnov3.0:JH579536.1:35937:44747:-1 gene:ENSDNOG00000046058 transcript:ENSDNOT00000041182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHVYRYLRAFLPESGFAILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKALRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERKGEG
AFRLRPKEPAPPRFPDKYELRETKRRLQQGQRGGAWQGLLGLRACTHPCPLRRDLFCAAC
QPFCLPPSSARPAVSPLWLQWLPQPPTRLRPRRRRRPRPRRTLALPVLRAARVPLHPWGG
CGPHCHLHAEALVALGAPPRARWAPQQDWHWARRYGLPAVVRVDLSRVAPVPPACPPAAG
APGPAPDPKRALAFAPFSPPKRLRLVVSHGSIDLDVNGDEP
Download sequence
Identical sequences ENSDNOP00000032334 XP_004480332.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]