SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032845 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032845
Domain Number 1 Region: 201-332
Classification Level Classification E-value
Superfamily TNF-like 5.2e-39
Family TNF-like 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032845   Gene: ENSDNOG00000039338   Transcript: ENSDNOT00000050742
Sequence length 333
Comment pep:novel scaffold:Dasnov3.0:JH564960.1:1143305:1162876:-1 gene:ENSDNOG00000039338 transcript:ENSDNOT00000050742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIIWWVLLAIGICMGSINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPG
LPGGPGKDGMKGEKGERGADGRVEAKGIKGEQGSIGPPGKHGPKGFVGPMGEKGLRGETG
PQGQKGGKGEVGPTGPGGLQGNAGPSGPMGPPGPVGPIGKPGPKGEAGPLGPQGEPGGRG
MRGWKGDRGEKGKMGETPVPPKSAFTVGLTVLSKFPSSDVPIKFDRILFNEFNHFDIATG
KFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKVLHTKDSYMSSEDQASGGMVLELKLGD
EVWLQASGGERFNGLFADEDDDTTFTGFLLFSS
Download sequence
Identical sequences XP_012378599.1.11602 ENSDNOP00000032845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]