SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032988 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032988
Domain Number 1 Region: 344-543
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.0000882
Further Details:      
 
Domain Number 2 Region: 254-311
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000155
Family SH3-domain 0.0033
Further Details:      
 
Domain Number 3 Region: 124-222
Classification Level Classification E-value
Superfamily PX domain 0.0000000235
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032988   Gene: ENSDNOG00000038252   Transcript: ENSDNOT00000042684
Sequence length 1769
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570039.1:11440:215084:-1 gene:ENSDNOG00000038252 transcript:ENSDNOT00000042684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQVTDSEEETREENLRKMKSSVHSEEDDFVPELHRNVHPRERPDWEETLSAMARGADVP
EIPGDLTLKSCGSTASMKVKHVKKLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEEQN
EVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLAELPRAD
ALKESPESVTQMLMAYLSRLSAIAGNKINCGPALTWMETDNKGTHFIVHAASSINTPAVV
ADHVSRGFSASHWLNYKVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVP
QSVTNSVPKPVSKKHGKLITFLRTFMKSRPSKQKLKQRGILKERVFGCDLGEHLLNSGFE
VPQVLQSCTAFIERYGISDTVHLICRLSFSTVFLSHEFDSEHVPDLTKEPYVQDIHSVGS
LCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHL
SLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVD
VLFSCKISAVIQEGAAKASLARPKSLLVSSPSTKLLTLEEAQARTQAQVTSPIVTENKYI
EVGEGPAALQGKFHTIIEFPLERKRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNES
EPSEMKALALNGGRAEGTLRSAKSEESLTSLHAVDGKTKSVHSFILKYFIEQLSHHFELL
DCQAPVPHDHESEEEAGLLHIPALVSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKVE
SECLESGASFLDSLGYSKDKPSTAKKDAEAGGSQSQTPGSTASSEPVSPLHEKLSPFFTL
DLSPTEDKSSKPSSFTEKVVYAFSPKLGRKLSKSPSMNISEPISVTLPARVAEAIVSASS
AAAQNASSPTRSTSAEESEVTHSSPTQVVKMQTNEREAQEGRDCGAQPLGQAAAGDVAPP
GTEEQPATSSQSKAVPAGQTQTGAVTYDPPQDSVPVSSVSLIPPPPPPKSVARMLALALA
ESAQQASTQSLKRPGTPQAGCVTYGDLAGASPEDKRPSPYAGCPLAAASLHTEVHTEVHT
EVPPEQPHVLSRGPPMPDAAAAGGSPHPRATGPGAQPLPADLPGPQPHRALPPGDPDAVT
APAAPVPDSEKPGGHVGFPEEHCGKRRTLTPPPTPGCLFSVSICCILFLCPLLLSSAARE
VWAAPFLGRLHPLSCWAALLTQRTPWTWGSPTWGHPCVAGHSLRASALRMGQLHTGQGGP
GFETQSFRDEAAPPAGNSALFLAVGVVDFRLSGSLSRCRTLVHGAAPAPEVPPGPRAVDE
PAAVFVRDDTAAPQCSFSTTALHPGLLEKTHEGARAALLHLRAEPVPMHASCGFSAPVPP
ARSLESKVAAAMHASITDAPGTSHYPSFVPASSASVDGVFPLPQPKHASQKTAYPAFARP
DVLAEPFGPETCLHFSMAPNCQYRPQSVPPHHGKLDQPPACGPRPEPAAPPGPRYNTYVA
PGRSASGPHARACSRGEYGASLSSASLRNACYADDVPPYPTIRRVQSLHVPPASMIRSVP
ISRTEVPPDDEPAYCPRPLYQYKPYQSPQARSDYHVTQLQPYFENGRVHYRYSPYSGAAG
PCYAPDAALCDVDAYGTVQLRPLHRLPARDLPFYTPRLQGKGLYAYPGLPPRPPAGCFAG
SDHHGVGGPAAADGAHTYASWDLEDLERYRLQSLRREGRARHKAKGAPASQYDNLAAAGP
DELAGALRPSTCAPGKTGLLSVAEGKDAR
Download sequence
Identical sequences ENSDNOP00000032988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]