SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000033137 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000033137
Domain Number 1 Region: 35-289
Classification Level Classification E-value
Superfamily SET domain 3.43e-57
Family RuBisCo LSMT catalytic domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000033137
Domain Number - Region: 306-395
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.0127
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000033137   Gene: ENSDNOG00000031640   Transcript: ENSDNOT00000037504
Sequence length 440
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573390.1:2607436:2630898:-1 gene:ENSDNOG00000031640 transcript:ENSDNOT00000037504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGRGRTSRIRRRKLFRSSESRGVTESYKPEFIELMKWLKDRKFEDNNLKPAHFPGTGR
GLMSKTSLQVGQMIISLPESCLLTTDTVIRSYLGAYITKWKPPLSPLLALCTFLVSEKHA
GDQSPWKPYLEILPKAYTCPVCLEPKVVNLLPRPLRAKAQEQRTHVQEFFTSSRDFFSSL
QPLFSEAVESIFNYSAVLWAWCTVNTRAVYMRHRQREGFSTEPDTYALAPFLDLLNHSPD
VQVKAAFNEETHSYEIRTASRCRKREEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR
DILVKYLPTTDKQMNKKISILKDHGFIENLTFGWDGPSWRLLTALKLLCLEAEEFTCWKK
VLLGEVISDTNEKTSLDISQKICSYFIEETNTMLQKVSRMKYEEVALINQLTLVETLWTE
ELKILQVSAEILNNLQTAFT
Download sequence
Identical sequences ENSDNOP00000033137 XP_004474534.1.11602 XP_004474535.1.11602 XP_012373458.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]