SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034147 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000034147
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000432
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 8.37e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 428-488
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000732
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034147   Gene: ENSDNOG00000034763   Transcript: ENSDNOT00000033977
Sequence length 500
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569306.1:179824:187377:1 gene:ENSDNOG00000034763 transcript:ENSDNOT00000033977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPVGGRPRGRRGPGAQQNIPSALLQDHENQRLFEMLGQKCWTLATAVVQLYLARPPG
AKHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYTQLVYFTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVHEKIQKRNQRQSGDRHQLPPPPPPANEERRGGLPPLPPH
PGGDLRSPPAGPLALGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRLGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPSTVGVNKGRSGPLPPVPMGGTPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPPPPPPPPPPPSSGNGPAAPPLPPVLGSG
GGPAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPSPPSSEGLVGALMHVMQKRSRAIH
SSDEGEDQAGDEDDDDEWDD
Download sequence
Identical sequences XP_004465032.1.11602 ENSDNOP00000034147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]