SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034566 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000034566
Domain Number 1 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 488-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-23
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 318-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 127-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000034566
Domain Number - Region: 189-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0239
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034566   Gene: ENSDNOG00000048898   Transcript: ENSDNOT00000036304
Sequence length 559
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575974.1:60000:67447:-1 gene:ENSDNOG00000048898 transcript:ENSDNOT00000036304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALMDPAQGCVTFEDVAIYFSQEEWGLLDEAQRLLYCDVMLKNFALMASLGLLSFRP
HIVAQLEMGEEPWVHDKVDMTSAPAKGASRGPGSGFWHGTESERSPSEHSVSVGVLQNRN
PKAVVSTQKDYSCDMCGLLLKDILHLAEHQAIHPRQKLYICGTYRRGFGFKSNLHQQQIQ
QNVEKSIRSDDAGASFIKSCRNGTSEKPCTCREDRRDFLARSGFLQYQATHSVREPHKNS
KGVMGFHTVQRHYKCIECGKAFSNKPTLVQHQRIHTGERPYECGECGKFFRQTSTLIIHQ
RIHTGERPYECSECGKIFSHCSGLFQHQRVHTGEKPYECECGKFFSHISSLIKHRRIHTG
EMPYECSECGKFFSQNSNLIQHQRVHTGERPYECSECGKFFSQSSNLIKHRRVHTGESPH
ECSECGKAFSYNSNLIKHRRVHTGERPYKCNECEKFFSHVSSLIKHRRIHTGERPYECSE
CGKLFSQKSLINHRRVHTGERPYECSECGKAFSQSSDLMKHRRVHTGERPYECSECGKAF
SQKSNLIQHQKLHKQDKPY
Download sequence
Identical sequences ENSDNOP00000034566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]