SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000693 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000000693
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000693   Gene: ENSDNOG00000000906   Transcript: ENSDNOT00000000906
Sequence length 72
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6469:50573:105748:-1 gene:ENSDNOG00000000906 transcript:ENSDNOT00000000906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IENEPDFGSTCLCLPEFVTLSIGLLCSDTNTVTCLLPIPRNDVSTEMYAVLTSEILVSIL
PSMATRLTKMNT
Download sequence
Identical sequences ENSDNOP00000000693 9361.ENSDNOP00000000693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]