SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001203 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001203
Domain Number 1 Region: 561-704,748-836
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-30
Family YWTD domain 0.000000345
Further Details:      
 
Domain Number 2 Region: 201-281
Classification Level Classification E-value
Superfamily GFP-like 1.99e-24
Family Domain G2 of nidogen-1 0.0000191
Further Details:      
 
Domain Number 3 Region: 432-537
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.67e-24
Family Thyroglobulin type-1 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 9-47,292-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 383-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000398
Family EGF-type module 0.068
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000001203
Domain Number - Region: 826-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000316
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001203   Gene: ENSDNOG00000001554   Transcript: ENSDNOT00000001556
Sequence length 864
Comment pep:novel genescaffold:dasNov2:GeneScaffold_2176:30734:79850:-1 gene:ENSDNOG00000001554 transcript:ENSDNOT00000001556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSYNTDARQTCANSRHQCSVYAECRDYPTGFCCSCVAGYTGNGRQCVTEGSPPGRNGKVR
GRVLVGSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXITSSSTREYTVTEPERDGATAAHTYTYQWRQTITFQECV
HDTSRPALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPVREGSPDALQNPCYIGSHGC
DTNAVCRPGSGTQFSCECSIGFRGDGRTCADIDECVEQPSVCGSHAHCNNHPGTFRCECV
EGYRFSDEGTCVAVVDQRPIDYCSSGLHDCDIPQRARCVYTGGSSYTCACLPGFSGDGRA
CQDVNECQPSRCHPEAFCYNTPGSFTCQCKPGYQGDGFRCVPGEVEKTRCQHEREHILGA
ADPQRPRPPGLFVPECDELGNYVPTQCHGSTGQCWCVDRDGRELEGTRTRPGVTPPCLST
VAPPIHQGPAVPTAVLPLPPGTHLLFAQTGKIERLPLEGSSMRKTEAKALLHAPDKVIVG
LAFDCVDKMVYWTDIGEPSIGRASLLGGEPMTIIRQDLGSPEGIALDHLGRNIFWTDSHQ
DRIEVAKLDGSQRRVLFESDLVNPRGIVTDSVRGNLYWTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTHRAECLNPQQPSQRRVLEGLQYPFAVTSYGKN
LYYTDWKTNSVIAVDLAISKEMDDYHPHKQTRLYGITTALSQCPRGHNYCSVNNGGCTHL
CLVTPGSRTCRCPDNTLGDCIERK
Download sequence
Identical sequences 9361.ENSDNOP00000001203 ENSDNOP00000001203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]