SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002284 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002284
Domain Number 1 Region: 242-407,747-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-71
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 2 Region: 499-742
Classification Level Classification E-value
Superfamily vWA-like 2.56e-71
Family Trunk domain of Sec23/24 0.00008
Further Details:      
 
Domain Number 3 Region: 949-1090
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.94e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00062
Further Details:      
 
Domain Number 4 Region: 844-948
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.37e-31
Family Helical domain of Sec23/24 0.0065
Further Details:      
 
Domain Number 5 Region: 410-495
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.28e-25
Family Zn-finger domain of Sec23/24 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002284   Gene: ENSDNOG00000002956   Transcript: ENSDNOT00000002956
Sequence length 1094
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6110:95742:125297:1 gene:ENSDNOG00000002956 transcript:ENSDNOT00000002956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSAPPVPPYGQPQPVYPGYHQSTYSGQPGATVPPIPYGAYNGPVPGYQQTPPPGVS
RAPSSSGAPPVSTAQAPCGQTAYGQFGQGDVQNGPSSTVQMQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPTSLVSASGSFPNSDLYG
SYAQGQAPPLSLTQSHPGVQPPQRSAPPQASSFTPTAPVGPRMPSMTGPLLSGQGFGGPP
MSQPNHVSSPPPQALPPGTQMTGPPGPPPPMHSSQPGYQLQQNGSFGPARGPQPNYGSPY
PGAPAFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASLYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNNKFPIPPAFIFMIDVSYNAIRSGLVRLLCEELKSLLDFLPREGGA
EESSIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVGDMFVPLLDGFLVNVNESRTVITS
LLDQIPEMFADTRETETVFAPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDD
RKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSV
YKYACFQVENDQERFLSDLRRDMQKIVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVEL
AGLDGDKTVTVEFKHDDRLNEENGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR
NCETDTLINYMAKFAYRGVLNSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILPEC
MKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSPIE
NTTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSV
LPVLDNPLSKKVRSLIDSLRAQRSRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVD
FLCHMHKEIRQLLS
Download sequence
Identical sequences ENSDNOP00000002284 9361.ENSDNOP00000002284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]