SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002524 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002524
Domain Number 1 Region: 449-673
Classification Level Classification E-value
Superfamily GFP-like 5.96e-82
Family Domain G2 of nidogen-1 0.000000619
Further Details:      
 
Domain Number 2 Region: 1060-1282
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-41
Family YWTD domain 0.000000322
Further Details:      
 
Domain Number 3 Region: 857-928
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-21
Family Thyroglobulin type-1 domain 0.00041
Further Details:      
 
Domain Number 4 Region: 933-1003
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 407-446,684-781
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000002524
Domain Number - Region: 771-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002524   Gene: ENSDNOG00000003255   Transcript: ENSDNOT00000003261
Sequence length 1294
Comment pep:novel genescaffold:dasNov2:GeneScaffold_870:44570:133583:-1 gene:ENSDNOG00000003255 transcript:ENSDNOT00000003261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGTNGIISTQDFPRETQYVDDDFPTDFPAIAPFLADIDTSHGRGRVLYREDTSPAVLDLA
SRYVRAGFASSAARFTPSHVFLVTWEQVGAYQEVTRGAQPAEELNTFQAVLASDKSDTYA
LFLYPANGLQFFGTRPKESYNVQLELPARVGFCRGETDDPKREGLYFSLTSTEQSVKNLY
QLSNLGIPGVWAFHIGSTSPLDNVMPATDGGQLPKSHSSPPLEHSFSHAAALEGDYTEDN
LEYYDENSEEVEYPPSEPEEAGNGHSRVEVSFHSEVDVKSSGESAILGPQTKEGMPLEGT
DTPDLKGQVEPSEQTATRSPTLPEKDGGSPDPSREAPKNKTIQPYPDGGAVPSEMDASPA
HPEGEVVFPHYPVPDHTPPLSGGRFVVRVEDDISSNTEVFAYNAASKETCEQNHGQCSRH
AFCTDYATGFCCHCQSRFYGNGRHCLPEGAPPRVNGKVSGHLRVGNTPVHFTDVDLHAYI
VGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGSENGFSLTGASFIHDMEV
IFHPGQERVHITQTAEGLDPENYLSIKTDIQGQVPYIPANVTADIAPYKELYHYSDSAMT
STSSRDYTLLFGAINQTRSYRIHQNITYQTCSHAPRHQVIPSTQQLNVDRVFALYNDEER
VLRFAVSNQVGPVEGDSDPTTVNPCYDGSHTCDTTAQCHPGTGVDYTCECAPGYQGDGRS
CVDVNECATGFHRCGPNSICINLLGSYRCECRSGYEFADDRHTCILTAPPPNPCEDGSHN
CAPAGQAWCLHHGGATFSCACRPGYTGDGHQCTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSGLKPCVHQQRYAQAQAAYPGSHPQIPQCDEQGNFLPLQCHGSTGF
CWCVDPDGHEVPGTRTPPGSTPPHCGPPEPTQRPQTVCEHWRKSLLEHYGGSPRDDQYVP
HCDDLGQFNPLQCHGKSDFCWCVDKDGREVPGTRSQPGTTPACIPTVAPPTVRPTPRPDV
TPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSIVVGIDYDCRERMVYWTDV
AGRTISRASLEPGAEPETIINSGLISPEGLVIDYFRRTMYWTDSGLDKIERAGLDGSERK
VLFHTDLVNPRAIAVDPVRGNLYWTDWNREAPKIEMSSLDGENRRILVNKDIGLPNGLTF
DPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLNYPFSIISYADHFYHTDWRIDGVISV
NKDSGQLTEEYLPEQRSHLYGITAVYPYCPAGRK
Download sequence
Identical sequences ENSDNOP00000002524 9361.ENSDNOP00000002524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]