SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003877 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003877
Domain Number 1 Region: 289-353
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000165
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003877   Gene: ENSDNOG00000005007   Transcript: ENSDNOT00000005007
Sequence length 575
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6535:5:17486:1 gene:ENSDNOG00000005007 transcript:ENSDNOT00000005007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSI
GFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFN
FFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGSGNDTWSKLPGIS
SIEQGMTGLKIGADLTAAVTKTVGTASSSTGMTSTATNSVPPVSSAAPKPTSWAAIARKP
AKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTIIQQPQ
PLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAPRNRGAGFN
QNNGVGNENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQ
VLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRVR
Download sequence
Identical sequences 9361.ENSDNOP00000003877 ENSDNOP00000003877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]