SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004409 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004409
Domain Number 1 Region: 223-289
Classification Level Classification E-value
Superfamily Homeodomain-like 1.88e-23
Family Homeodomain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000004409
Domain Number - Region: 83-131
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00126
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004409   Gene: ENSDNOG00000005697   Transcript: ENSDNOT00000005690
Sequence length 385
Comment pep:novel scaffold:dasNov2:scaffold_26627:5043:9970:1 gene:ENSDNOG00000005697 transcript:ENSDNOT00000005690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQTTPSPCSEIDTVG
TAPSSPISVTMEPPEPHLVAEGPQHHLHLHHGQQPPPPAAAPAQSLQPSPQQQPPPPQQP
PPAQQLGSAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQEGTAAHESF
RPKLEQEDGKTKLDKREDSQNDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDH
QLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAG
NYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLI
HGLGPGGQPALNPLSNPIPGTPHPR
Download sequence
Identical sequences ENSDNOP00000004409 9361.ENSDNOP00000004409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]