SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004449 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000004449
Domain Number - Region: 467-497
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0238
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004449   Gene: ENSDNOG00000005746   Transcript: ENSDNOT00000005745
Sequence length 693
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1164:190256:196569:1 gene:ENSDNOG00000005746 transcript:ENSDNOT00000005745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVRTLQELLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDAEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKEAEKEEKDLGMVHRDAEKEQEEEQNQEV
GFKMEEETEVREEKQQDPEKVMDVLEIVENVKNVIAEQEVMETNLVKSGEHSEYKISKGM
EPEMEFEVKTDKERESLSPGKKNSIALEIKKKPEEKEEKRSVSQRKPMAQPQLQPQPQPQ
SQSQSQPVLQPQSLSQPETLPLAVLELPVESVKLFDVPVELVLTEKLSKSKTKTRKRRRG
WTRNKTSKSRSQSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSS
TTSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGIERSHKSSKGGSSRDTKGSKDKNSR
SDRKRSISESSRSGKRSSRSERDRKSDRKDKRR
Download sequence
Identical sequences ENSDNOP00000004449 9361.ENSDNOP00000004449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]