SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004710 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000004710
Domain Number - Region: 8-67
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00366
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 
Domain Number - Region: 101-273
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0915
Family LacY-like proton/sugar symporter 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004710   Gene: ENSDNOG00000006075   Transcript: ENSDNOT00000006078
Sequence length 309
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4955:117032:123239:-1 gene:ENSDNOG00000006075 transcript:ENSDNOT00000006078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPSAPPPYEDRNPLYPGPPPAGGYGQPSVPRGGYPAYPSYPQPGYGHPAGYPQPMPPI
HPMPMNYGPGEGYGGEERAVSDNFGPGEWDDRKVRHNFIRKVYTIISIQLLITVAIIAIF
TFVEPLSTFVTRNVAYYASXAVFLATYLTLACCQGPRRRFPWNIILLALFTLALGFMTGT
ISSMYGTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCAGLFCVLGIVLMVTGIVTAIVL
SFKYVYWLHMLYAALGAIAFTLFPAYDTQLVLENRKHTISLDYITGGLQIYTDVIYIFPF
VMQLVGNRD
Download sequence
Identical sequences 9361.ENSDNOP00000004710 ENSDNOP00000004710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]