SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006012 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006012
Domain Number 1 Region: 662-859,1202-1278
Classification Level Classification E-value
Superfamily SET domain 7.85e-76
Family Histone lysine methyltransferases 0.00024
Further Details:      
 
Domain Number 2 Region: 594-668
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000589
Family Methyl-CpG-binding domain, MBD 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006012
Domain Number - Region: 259-310
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00271
Family Tudor domain 0.014
Further Details:      
 
Domain Number - Region: 445-586,1244-1256
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0915
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006012   Gene: ENSDNOG00000007754   Transcript: ENSDNOT00000007755
Sequence length 1288
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3797:721:40512:1 gene:ENSDNOG00000007754 transcript:ENSDNOT00000007755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPGCLGLDAAPAAVESEEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLHYRESSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPVEPPQPTAPPAPPVPPAPPAPPLSPQAADNDL
ESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENIPGGKPGISQTYRSPLGSTASA
PAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRSEQYRGKNPLLV
PLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDP
YVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTG
PEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQTNPNSGYQYKRLEECLPTGVYECN
KRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFA
DKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESN
DDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPPDLGPPLIPVPPS
IPVGGCNPPSSEETPKNKVASWLSCNNVSEGGFADSDSRSSFKTSEGGEGRSGGGRGEAE
KASTSGLGIKDEGDIKQAKKEDPDDRNKMSVITESSRNYGYNPSPMKPEGLRRPPSKTSM
HQSRRLLASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGSEG
DDFEDKKNMSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESVPVRKNTRQFYD
GEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPVAFFASKRIRAGTELTW
DYNYEVGSVEGKELLCCCGAIECRGRLL
Download sequence
Identical sequences 9361.ENSDNOP00000006012 ENSDNOP00000006012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]