SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006486 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006486
Domain Number 1 Region: 46-302
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-35
Family YWTD domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 578-737
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-24
Family YWTD domain 0.00021
Further Details:      
 
Domain Number 3 Region: 312-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 743-781,837-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 973-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006486
Domain Number - Region: 917-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000287
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006486   Gene: ENSDNOG00000008347   Transcript: ENSDNOT00000008372
Sequence length 1204
Comment pep:novel genescaffold:dasNov2:GeneScaffold_7210:281940:382281:1 gene:ENSDNOG00000008347 transcript:ENSDNOT00000008372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPLLTLLLSVVLKCSWVGVSARQPWSCPGGPSSGSENATCAGPAPFLIFSHGNSIFRID
LEGTNHEQLVADAGISVIMDFHYYKERIYWVDLERQLLQRVFLNGTGQESVCNIEKNVSG
MVINWINEEIIWSNQQEGIITVTDMKGNNSRVLLNALNCSANIAVDPVDRFLFWSSEMAS
SIHRTDLDGVDVRILLETSEKITAMSLDVLDKRLFWIQYSREGSSSHVCSCDYDGGSVHF
SKHLTQHNLFAISLFGDRIFYSTWKKKTIWIANKYTGKDIVKINLNPSSVPPGEIKVVHP
LAQPKAKGDAWESDQKLCKPRKGNCRGSVCGQDPKSHLCICAEGYTINQDGQYCEDVNEC
ALWNHGCTLGCENTPGSYYCTCPVGFVLLPDGKRCHEFVSCPSNGSECSHDCVLTSDGPI
CFCPEGSRLEADEKTCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PPPFLLFANSQDIRHIHFDGTDYGTLLSQQIGMVFALDHDPVENKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLIQRSDLNGKHHEVIIKENLSQP
RGIAVHPKAKRLFWTEMGINPRIESSSLQGFGRLVVASSDLVWPSGITIDYLTDKLYWCD
AKQSVIEMANLDGSKRQRLAQNDVXXXXXXXXXXDHVWFSDWAMPSVIRVNKWTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLHQNGGCEHICKEKFGTAQCSCREGFMKAPDGKMC
LTLNGHHLLAGNEAHLSKQETPPDTLSRSGVFEDDITEGLQLQHMLVAEIMVSDQDDCAL
LGCDIHAGCVSKGEDARCQCLKGFAGDGKLCSDIDECAMGVTVCPPTSSKCINTEGGYVC
RCSEGYQGDGVHCLDIDCQLGMHTCEGNATCINTEGNYTCERAGGLSDPGPICSDSTPPS
HLRDDDLYPVRNSYPGCPLSLDGYCLHGGVCMYIEAVDRYACNCLVGYVGERCQHRDLWE
LRRAGQERQRNLTAVAXXXXXXXXXXXXXXXXXXXXXTQELLSNPKNPYEESSVRQCRAA
DSKAGXXXXXXXXFVVIEEHQAIRNGNQPVTLRESQAADVGSVQLTSWRKEPQICGMGTE
QGCWIPPPSDKGSGFQGMEQSFHLPSYRAQRIAVGVEKPHSLLSANPLEQQRAPDRPHRM
DLTQ
Download sequence
Identical sequences 9361.ENSDNOP00000006486 ENSDNOP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]