SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006940 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006940
Domain Number 1 Region: 170-229
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000261
Family Homeodomain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006940
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0654
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006940   Gene: ENSDNOG00000008959   Transcript: ENSDNOT00000008950
Sequence length 229
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6659:526058:559632:-1 gene:ENSDNOG00000008959 transcript:ENSDNOT00000008950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPLFGCLRSPHAAAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG
NSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPSEAEKRSGGKRKSDSSDSQEGNYKS
EVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQ
Download sequence
Identical sequences 9361.ENSDNOP00000006940 ENSDNOP00000006940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]