SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007029 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007029
Domain Number 1 Region: 323-613
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-63
Family Kelch motif 0.00019
Further Details:      
 
Domain Number 2 Region: 8-62,119-183
Classification Level Classification E-value
Superfamily POZ domain 3.77e-27
Family BTB/POZ domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000007029
Domain Number - Region: 79-106
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0131
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007029   Gene: ENSDNOG00000009087   Transcript: ENSDNOT00000009079
Sequence length 629
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6943:964:92113:-1 gene:ENSDNOG00000009087 transcript:ENSDNOT00000009079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHWHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQQPPPQQQPPQQQQQQPQEEPGTPSSSPDDKLLTS
PRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLN
DQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELAL
FQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAM
NYHLMPFRQHCRQSLASIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMP
YNSAHHCVVEVENFLFVLGGEDQWNPNXXXXXXXXXXXXXXXXXXXXXXXXXXXRASFYA
CRLDKHLYVIGGRNESGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHSGKIYISGGV
HNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVMLV
ECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTW
TELEGDVAEPLAGPACATVILPACVPYNK
Download sequence
Identical sequences ENSDNOP00000007029 9361.ENSDNOP00000007029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]