SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007395 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007395
Domain Number 1 Region: 612-867
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 2-262
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-54
Family YWTD domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 914-1056
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-16
Family YWTD domain 0.00096
Further Details:      
 
Domain Number 4 Region: 313-441,490-539
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000327
Family YWTD domain 0.00062
Further Details:      
 
Domain Number 5 Region: 1301-1338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 289-306,571-607,861-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000138
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000007395
Domain Number - Region: 1182-1221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000314
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007395   Gene: ENSDNOG00000009528   Transcript: ENSDNOT00000009539
Sequence length 1582
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4841:202:183509:1 gene:ENSDNOG00000009528 transcript:ENSDNOT00000009539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGGAKLESTIVVSGLEDAAAVDFQFSRGAVYWTDVSEEAIKQTY
LNRTGAAVQDVLVSGLVSPDGLACDWVGKKLYWTDSETNRLEVANLDGTSRKVLFWQDLD
QPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIVVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFRQKVVESSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKR
KEVLGALYSPMDIQVLSQERQPYXXXXXXXXXXXXXXXXXXXXXXXXXACACPTGVQLQG
DGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLPVDDVRHAIAIDYDPLEGHVYWTD
DEARAIRRSPPPASDGQTLVRTEIDPEAITVDEVAPNLWTDTCTDRIDVTRLNGTSHKIW
VSENRDEPQAIMVHPVMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHK
VQASRDVIVDQLPDLMGLKAVNVARAVGTNPCAEGNGGCSHLCFFTPRATRCGCPIGLEL
LSDRRTCIVPEAFLVFTSRAAIHRISLETSNNDVAIPLTGVKEASALDFDASNNHIYWTD
VSLKTISRAFMNGSSVEPVIEFGLDYPEGVAVDWMGRNLYWADTGTNRIEVARLDGQFRQ
VLVWRDLDNPRSLALDPTRGYIYWTEWGGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDY
ASQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADK
TSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHNNGQCGQLCLAVPGGHRCGCAAHYT
LDPSSRNCSPPTTFLLFSQKCAISRVIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYW
VDGRQNIKRAKDDGTQPSVLTSPGQGQNPDRQPHDLSLDIYSRTLFWTCEATNTINVHRL
SGEAMGAVLCGDRDRPRAIVVNAERGYLYFTNMQDRAAKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHPCARDNGGCSHICIAKGD
GTPRCSCPVHLVLLQNLLTCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCLPNQFRCASGQCVLIKQ
QCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQ
RYAGASGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCGKSMMSSVSLMGGRGGVPLY
DRNHVTGASSSSSSSTKATLYPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYII
RGMVPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPS
PATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences 9361.ENSDNOP00000007395 ENSDNOP00000007395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]