SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000007649 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000007649
Domain Number 1 Region: 197-272
Classification Level Classification E-value
Superfamily Homeodomain-like 9.84e-28
Family Homeodomain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000007649
Domain Number - Region: 91-122
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00212
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000007649   Gene: ENSDNOG00000009877   Transcript: ENSDNOT00000009873
Sequence length 410
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4288:302769:359325:-1 gene:ENSDNOG00000009877 transcript:ENSDNOT00000009873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAETCVSYYESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAASKGQGFGDA
KSRARYGAGQQDLAAPLESGAGARGSFNKFQSQPQPQPPAPQPPQPQPQPQPQPPAQQSH
LYLQRGACKTPPDGSLKLQEGSGGHNAALQVPCYAKESSLGEPELPPDSDTVGMDSSYLS
VKEAGVKGPQDRASADLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDV
YAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYA
QIQNPSWIGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASGVTDFLSVSGAGGHVGQ
THMGGLFGAAGLSPGLNSYELNGEPDRKSSSIAALRMKAKEHSAAISWAT
Download sequence
Identical sequences XP_004467334.1.11602 9361.ENSDNOP00000007649 ENSDNOP00000007649 ENSDNOP00000007649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]