SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000008177 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000008177
Domain Number 1 Region: 1873-2156
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.44e-73
Family Protein kinases, catalytic subunit 0.000000273
Further Details:      
 
Domain Number 2 Region: 497-625
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000202
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 3 Region: 1636-1787
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000053
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 4 Region: 943-1086
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000059
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 1096-1360
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000772
Family YWTD domain 0.013
Further Details:      
 
Domain Number 6 Region: 1396-1525
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000456
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 7 Region: 238-459
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000353
Family YWTD domain 0.0059
Further Details:      
 
Domain Number 8 Region: 620-708
Classification Level Classification E-value
Superfamily YWTD domain 0.0000562
Family YWTD domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000008177
Domain Number - Region: 44-89
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00195
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000008177   Gene: ENSDNOG00000010519   Transcript: ENSDNOT00000010555
Sequence length 2185
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1631:89261:208656:-1 gene:ENSDNOG00000010519 transcript:ENSDNOT00000010555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIQGCHFWNSVDQEKCALKCRESCEVGCSSAEGAYDEHSLENADLPTAPFASSIGSHHVT
LRWNAANISGIKYIIQWKYTQLPGSWTYTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXPERAAPFIRNIESSSPDTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEEEQWLFL
SRNSSLRKRSLKHLVDEAHCLPSNATHHDITGISVNVQKQVVYFSERNLIWVKAAANMSD
VADLRIFYRGSGLISSISIDWLYQRMYFIMDELVCVCDLENCSTVEEITLPSIIAPQKIV
ADSYNGYVFYLLRDGIYRADLPVPSERGSEAVRVVESCTLKDFVVKPQSKRIIYFNSTAQ
AFMSTFLDGSASHLVLPHVRFADVKSFACENSHFLATDGKAVFQQDSLSFNEFIVGCDLS
HIEEFGFGNLVIFGSTTQPHPLPGRPQELSVLFGSHQALVQWQPPALAIGANVILVGNID
LFLGPSAWQNWTYEVKMSTQDFLETTQFFSNISGTMLNVPELQSSTKYKVSVRAISPKGP
GPWSEPSVGTTLVPATEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWYNNSL
FYSDMKGDVYVWLLNGTDVSENYHISNIAGAGALAFEWLGHYLYWAGKTYVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIALT
LDFSDGLLYWLVQDSQCIHLYTAVLRGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLASEQQSLPVLTVEGLEPYALLTLS
VTPYTYWGKGPKTSLSLRAPETVPSAPENPRIFILPSGKYGNKNETVVEFRWNKPKHENG
VLTRFEIFYQISNQSDTNKTFKDWIAVNVTPSVMSFQLEGMSPGYIICQVRVFTSKGSGP
FSNIEKANTSVINPVPYLITLFGNKITFLDMDQNQVVWMFSGERDIRAVGYTADNEMGYY
AQGDSLFLLNMQSHSSSELFRDALVFDITVMTVDWISRHLYFVLQESQNGMQIFDVDLEC
KVKYPRLLKIGNRNSTIISFSVYPFLSRLYWTEVSNFGCQMFYYSIINQTLHQILQTITT
NHQNGRGQCSCNVTEFELSGAMTIDTSDLKKPCIYFVKGQEIWAMDLEGCMCWRVIMVPA
MLAGKTTSLTVDRKFLYWIVTEKDSTQLYQAKKRNGAIPSQVKASMSEHIVAYSPVMQPF
PDKVFLSPASNTEEPTILNATNTSLTIGLPPVSPRLPWFGISNPTPTYLVYYREVNGTKN
GSDLPYRMLEFQDRRALIEGLQPFSTYMIQIAVKNYYSDLLEQLPLGKEICGTTKSGVPG
AVWLINTTVWSDTSLIISWREPHKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXWKYTEFYRINGSCSPGPVYMCNITDLQPHTSYNVRIVVVYVTGENS
TSLPESFKTKAGVPSKPGIPKLLEGSKNSIQWEKADHGSRIMYYIXXXXKGTSNDSKNSS
LWWKTAFNGSCSSICTWKSKNLKGTFQFRVVAANNLGFGEHSGISENIILAEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXWHRRLKNQKTPKEGLAVLINEDKELAELRGLAAGVGLAS
ACYAIHTLPTQDEIESLPTFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGETKVAVK
TLKKGSTDQEKIEFLKEAHLMSKFDHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRR
ARKTTFHGPLLTLVDLVNMCVNISKGCVYLEQMPFIPRDLAAPNCLVSVKDYTSPSRIVK
IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGH
QPYPAHSNLDVLTYVQTGGRLEPPRNCPNDLWTLMSQCWTQEPDQRPTFHKIQDQLQLLR
NFSLNSISQCSDKAKTLGVINEGFE
Download sequence
Identical sequences ENSDNOP00000008177 9361.ENSDNOP00000008177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]