SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009505 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009505
Domain Number 1 Region: 621-754
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.88e-42
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000153
Further Details:      
 
Domain Number 2 Region: 276-392
Classification Level Classification E-value
Superfamily vWA-like 6.56e-37
Family Trunk domain of Sec23/24 0.0000727
Further Details:      
 
Domain Number 3 Region: 8-66,409-436
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 8.63e-30
Family beta-sandwich domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 4 Region: 579-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 2.88e-16
Family Helical domain of Sec23/24 0.0006
Further Details:      
 
Domain Number 5 Region: 49-100
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0000000000000225
Family Zn-finger domain of Sec23/24 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009505   Gene: ENSDNOG00000012225   Transcript: ENSDNOT00000012241
Sequence length 758
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1164:3375:103391:-1 gene:ENSDNOG00000012225 transcript:ENSDNOT00000012241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTFPNTGARIMMFIGGPATQGPGM
VVGDELKIPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI
GPCISLNSKGPCVSENXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEAVSDSSSIADRILMTFQMYHGETIAQW
RKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPVPRYIDTEHGGSQARFLLSKVNPSQT
HNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences ENSDNOP00000009505 9361.ENSDNOP00000009505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]