SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010090 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010090
Domain Number 1 Region: 572-814
Classification Level Classification E-value
Superfamily vWA-like 4.36e-76
Family Trunk domain of Sec23/24 0.00000619
Further Details:      
 
Domain Number 2 Region: 343-490,815-909
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.35e-74
Family beta-sandwich domain of Sec23/24 0.00051
Further Details:      
 
Domain Number 3 Region: 1016-1164
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.71e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.002
Further Details:      
 
Domain Number 4 Region: 911-1015
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 2.88e-29
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 489-571
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.7e-23
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010090   Gene: ENSDNOG00000012980   Transcript: ENSDNOT00000013000
Sequence length 1165
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3522:63493:158790:1 gene:ENSDNOG00000012980 transcript:ENSDNOT00000013000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYCAGLYTVPQNVVTTSTVNHSPGAQQMYGRPPAPHIMRSTLRSFQDAASSASHLHTSDS
QPYSSFVNHYNSPAMYSSVASQGFPSTCAHYAMSTVSNAAYPSVSYPSLPAADPFGQMFT
SQNAPTVRPVKDNSFPSQHTAISHPSPLPPPPSQQPQQQQNLSGYNTLSWSAPGLPATQD
NPVQNHTGSLVTANNATNTVADSLSCPVMQNVLPSKPSPLVSTVLSGASSPRMPPAATHP
VEPVAPVTQPSELLQQKGMQFGEYVNNQASSAPTPLSSTSDDEEEEEEDEEAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXMLSSSASSPAPDPAPEPDPAPAPAPAAPQPAKVAKPFGYG
YPTLQPAYQNTTAPLNSGVQPNNPVYSGFQQYAQYPGMNQLSSSLGGLSLQSSPQPESLR
PVNLTQERNILPTTPVWAPVPNLNLDLRKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGL
LLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNP
LTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAVESGYLTILCQSL
LENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLSQPQMLIVSHIDDVFLPTPDSLLVNLY
ESKELIKDLLNALPNMFTHTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLL
QSREDPNQRSSTKVVQHLGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKY
SAGCIYYYPSFHYTHNPSQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFV
RSTDLLSLANINPDAGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVV
SSLADVYSGVDVQAAICLLANMAVDRSVSSSLSDARDALVNAVVDSLSAYGSTLSNLQHS
ALIAPSSLKLFPLYVLALLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMKMIHPNLYR
IDRLTDEGAVHVNDRVVPQPPLQKLSAEKLTREGAFLLDCGSVFYIWIGKGCDNNFIEDV
LGYPNFASVPQKMTHLPELDTLSSERTRSFITWLRDSRPLSPILHVVKDESPTKMEFFQH
LIEDRTEAAFSYYEFLLHVQQQICK
Download sequence
Identical sequences 9361.ENSDNOP00000010090 ENSDNOP00000010090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]