SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010705 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010705
Domain Number 1 Region: 493-734
Classification Level Classification E-value
Superfamily vWA-like 1.22e-57
Family Trunk domain of Sec23/24 0.0000186
Further Details:      
 
Domain Number 2 Region: 266-380,735-827
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.79e-45
Family beta-sandwich domain of Sec23/24 0.00076
Further Details:      
 
Domain Number 3 Region: 411-492
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.89e-23
Family Zn-finger domain of Sec23/24 0.00027
Further Details:      
 
Domain Number 4 Region: 950-1047
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.91e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010705   Gene: ENSDNOG00000013795   Transcript: ENSDNOT00000013814
Sequence length 1047
Comment pep:novel genescaffold:dasNov2:GeneScaffold_4368:56088:215696:1 gene:ENSDNOG00000013795 transcript:ENSDNOT00000013814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPTSLQIQNGTSSALGSPYINGPVQNISTSSQVPVSQGYNSQLTGPYPHLIPAKTAL
NPVSGQPNYGGSQRPGQTLNRAPMASNPVTASFHSGPVPRMSPPPSQHPAATPMPSGSFL
PGANPPPPLNWQYNYPSPGPQTNHCPHASSQPILSGNTDLITNHQRVSSGDPSLQNSYLK
SGSAPPSVNPPLPTTFQPGTPLGPPPVAGPPPVRALTPQKSSHSTVPQPSFNSAINQEXX
XXXXXXXXXXXXXXXXXXXXXXXXXTPQFTNKNPKMARSVGYSYPSLPPGYQNTTPPGTT
GMPSSSLNYPSGPLAFSQTSLGANHLTASMRGLSLHPEGLRVINLLQERNMLPATPLQPP
VPNLHEDIQKLNCNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLPVVTSSTI
VRCHSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPLTRVYGEPHRRPEVQNATI
EFMAPSEYMLRPPQPPVYLFVFDVSHNAIETGYLDSVCQSLLDNLDLLPDNTRTKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVFIPMPENLLVNLNESKELVQDLLKSLPQMFTK
TLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPNLGVGALKPREEPNQRSSAKEIHLTP
STDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQHNPVQV
QKLQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGYAVQ
MSVEDNLIDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQAISGLLA
NMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGALNINDKTIPQP
PILQLSVEKLSRDGAFLLDAGSVMMLWVGKNCGQNFLSHVLGVQSYVSIPQTMTELPELD
TPESARTVAFISWLREQRPFFPILYII
Download sequence
Identical sequences ENSDNOP00000010705 9361.ENSDNOP00000010705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]