SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010911 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010911
Domain Number 1 Region: 70-131
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000034
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010911   Gene: ENSDNOG00000014056   Transcript: ENSDNOT00000014051
Sequence length 464
Comment pep:novel genescaffold:dasNov2:GeneScaffold_7156:122113:420248:-1 gene:ENSDNOG00000014056 transcript:ENSDNOT00000014051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFTDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRTRDKEQQQQQQQQRQQQQQQQQRQRQQQQQQQQQRQRQQEPSWPALLASMRESS
PAAQAHRLLSASSSPTLPPSSGDGGGGGQSNRGKNNRSKALFLGNSAKPVWRLETCYPQG
ASSGQCFTIENADAVCARNWSRGVAAGGEEQQVRGKPPTPLWNLSDFYLSFCNSYTLWEL
FSGLSSPNTLNCSLDVVLKEDGEMTACRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEE
YSVKSCPEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYG
GLSSFICTGLYETFLTNDEPECCDVRREEQSNNLSKGTVEKSDSCHRTSLTVSSATRLCN
SRLKLCVLVLMLLHTVLTASAAQNTTGLSFGGINTLEENSTNEE
Download sequence
Identical sequences 9361.ENSDNOP00000010911 ENSDNOP00000010911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]