SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011250 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000011250
Domain Number - Region: 5-76
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000837
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011250   Gene: ENSDNOG00000014525   Transcript: ENSDNOT00000014518
Sequence length 693
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1649:24318:45895:-1 gene:ENSDNOG00000014525 transcript:ENSDNOT00000014518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKPGQPQPQHHHSHHHPHHHPQQQQQQPPHHHHHYYFYNHSHHHHHHHQQPHQYLQHG
AEGSPKAQPKPLKHEQKHALQQHQETPKKKTGYAELNGNAGKREISLKSLGSDEASNPIS
RVLSGNQQLVDTDLKQTVKASTFGRGGIKTKNFIQKNSMDKKNGKSYENKSGENQSVDKT
DAVAIPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNLVQ
DKIMQQETSVPSLKQGLETFKPDYSEQKGNRADGSKPIWKYDTGLGGTSRGKSTVGDVLR
KSSDVKPGVSSKKFDDRPKGKHASAVASKEDSWTLFKPPPVFPVDNSSAKIVPKISYASK
VKENLNKTVQNSFVSPSSSSCSSSSTGETQTQSSSRLSQVPMSALKSVTSAGFPNGPVLA
GPDASGYSPRGQPLLTTAANTLTPISSGTDSVLQDTSLTSAAVEQMKSSLFIYPSNTQAV
LLSTTQVDLPSQTDQQNLGDIFQNQWGLSFINEPSAGPETVTGKSSDHKVMEVTFQGEYP
ATLVSQGAEIIPSGTEHPVFPKAYELEKRTSRQVLGNILKPGTTSESGALSLEPSHIGDL
QKADTSSQGVLFLSKDHEIENQNPMASPMNTLLGSVKEQKHQRDLKRNYSLGSFDLRAAI
VYHTKEMESIWNLQKQDPKRIITYNEAMDSPDQ
Download sequence
Identical sequences ENSDNOP00000011250 9361.ENSDNOP00000011250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]