SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011628 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000011628
Domain Number 1 Region: 1276-1315,1348-1566
Classification Level Classification E-value
Superfamily YWTD domain 1.46e-22
Family YWTD domain 0.012
Further Details:      
 
Domain Number 2 Region: 926-1001
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000883
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1464-1664
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000183
Family Soluble quinoprotein glucose dehydrogenase 0.03
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000011628
Domain Number - Region: 675-700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000326
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 772-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 742-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 608-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00242
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 643-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 802-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00806
Family EGF-type module 0.095
Further Details:      
 
Domain Number - Region: 578-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011628   Gene: ENSDNOG00000014992   Transcript: ENSDNOT00000015002
Sequence length 2513
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3990:10224:608629:1 gene:ENSDNOG00000014992 transcript:ENSDNOT00000015002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNR
VTDLVHRESDEFPRQGTNFTLAELGICEPSPHRSGYCSDMGILRQGYSLSTGSDADSDTE
GGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDENGRPIPPTSSSSLL
PSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSXXPP
NHHSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRK
AFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGIRT
GLPGNDDVATMPSGGKXXXXXKNSSIDSCEAEVRRVTQEVPPGVFWRSQIHISQPQFLKF
NISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVFV
QYLDVGLWHLAFYNDGKDKEMVSFSTVVLDSVQDCPRNCHGNGECVSGMCHCFPGFLGAD
CAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPLNQCIDPSCGGHGSCIDGNCVCSAG
YKGKHCEEVDCLDPTCSSHGVCVSGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTG
LCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCK
DGKCECREGWNGEHCTIVEETNGCPDLCNGNGRCTLGQNSWQCICQTGWRGPGCNVAMET
SCADNKDNEGDGLVDCLDPDCCLQSACQSSLLCRGSRDPLDIIQQGRATAPAVKSFXXXX
XXXXXXXXXXXXXXXXXXXXXLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDG
TFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVR
PDPIIISSPLSTFFSAVPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKIT
MTQSTVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXNKEFLNNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGAKDLAGNSE
VVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIIS
TLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVS
IIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTN
GEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYVADLGNIRI
RAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTE
LVDNNGNSLKIRRDSSGTPRHLLMPDNQIITLTVSTGGGLKVVSAQNLELGLMTYDGNTG
LLATKSDETGWTTFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHGRNLLSIDYDNIRTEKIYDXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIASIKPVIS
ETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMF
RSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDL
NGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTR
AYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYY
DLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMV
IGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSH
ELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQ
Download sequence
Identical sequences ENSDNOP00000011628 9361.ENSDNOP00000011628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]