SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000011860 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000011860
Domain Number - Region: 30-61
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0262
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000011860   Gene: ENSDNOG00000015298   Transcript: ENSDNOT00000015297
Sequence length 368
Comment pep:novel genescaffold:dasNov2:GeneScaffold_3829:45489:132916:1 gene:ENSDNOG00000015298 transcript:ENSDNOT00000015297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASEDRMAEEGGGGPGDGCSSSAACSGQRQPPPPPPQPSQPGSQALPAQALAPDQLPQ
NNTLVALPIVAIENILSFMSYDEIRTLRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRV
LRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQD
QKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQSEESPRKRKKAAEAIDSLRK
SKRLRNRK
Download sequence
Identical sequences ENSDNOP00000011860 9361.ENSDNOP00000011860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]