SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012012 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012012
Domain Number 1 Region: 54-320
Classification Level Classification E-value
Superfamily vWA-like 6.04e-90
Family Trunk domain of Sec23/24 0.00000066
Further Details:      
 
Domain Number 2 Region: 588-660
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.18e-27
Family C-terminal, gelsolin-like domain of Sec23/24 0.00012
Further Details:      
 
Domain Number 3 Region: 444-505
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.18e-22
Family Helical domain of Sec23/24 0.0001
Further Details:      
 
Domain Number 4 Region: 364-443
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.41e-22
Family beta-sandwich domain of Sec23/24 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012012
Domain Number - Region: 1-22
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0157
Family Zn-finger domain of Sec23/24 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012012   Gene: ENSDNOG00000015494   Transcript: ENSDNOT00000015494
Sequence length 662
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1203:466:74280:1 gene:ENSDNOG00000015494 transcript:ENSDNOT00000015494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVDYRAKLWACNFCFQRNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGPQTPLIFLYV
VDTCLEEDDLQALKESLQMSLSLLPPDALVGLVTFGRMVQVHELSCEGISKSYVFRGTKD
LTAKQIQDMLGLTKPTMPMQQARPSQPQEHPFVSSSFLQPIHKIDMNLTDLLGELQRDPW
PVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGPGMVVGDELKTPIRS
WHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLLEMKCCTNLTGGHMV
MGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLEVKXXXXXXXXXXXXXXXXXXXXXXX
XXXXELGVGGTSQWKVCGLDPTSTLGIYFVVNHNAPIPQGGRGAIQFVTQYQHSSTQRRI
RVTTIARNWADAQSQLKHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDRQLIRLC
QKFGQYNKEDPTSFRLSDSFSLYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIAQWRKAGYQD
MPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAW
GQ
Download sequence
Identical sequences ENSDNOP00000012012 9361.ENSDNOP00000012012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]