SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012175 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000012175
Domain Number - Region: 144-196
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 
Domain Number - Region: 245-301
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0199
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012175   Gene: ENSDNOG00000015696   Transcript: ENSDNOT00000015700
Sequence length 1288
Comment pep:novel genescaffold:dasNov2:GeneScaffold_1806:12659:149207:-1 gene:ENSDNOG00000015696 transcript:ENSDNOT00000015700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGAAAPRGPAAALEPRRLPAARWPGRRSLPRRGGRGGSGAGPGLYPSAAPPPPGPGPP
PSRQRSLPSASDCFGSNGGGAARPGSQRLLGLGGPSRPFIVLLLPLAGLGAPPAAPARAS
PPRSGVPSARPAPGCPRLACGPVYGPLTMSLKPQQQQQQQQQQQTAAANARKPGGGLLTS
PAAAPSPSSASSPSPSAAASSSSAAAAAASASSGRPGLGRGRNSSKGLSQSTISFDGIYA
NMRMVHILTSVVGSKCEVVKNGGIYEGVFKTYSPKCDLVLDAAHEKSTESGSGPKREEIM
ESILFKCSDFVVVQFKDMDSSYARRDAFTDSAISAKVNGEHKEKDLEPWDAGELSTNEEL
EALENDVSNGWDPNDMFRYNEENYGVVSTYDSNLSSYTVPLERDNSEEFLKREARANQLA
EEIESSAQYKARVALENDDRSEEEKYTAVQRNSNEREGHSINTRENKYIPPGQRNREVIS
WGSGRQNSPRLGQPGSSSMPSRSTSHTSDFNPNSGSDRRVVNGSVPWPSPCPSPSSRPPS
RYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRLSP
KTHRPRSPRQNSIGNTPSGPVLASPQPGIIPAEAVAMPIPAASPTPASPASNRAVTPSLE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSTKDSFIENSSSNCTSGSSKPNSPSIS
PSILSNSEHKRGPEVTSQGVQTSSPGCKQEKDDKEEKKDAAEQVRKSTLNLNAKEFNLSF
FSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQPLYPIP
MTPMPVNQAKTYRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHPHVYSPVIPSNARMMAPPTHAQPGLVSSSATQFGAHEQAHAMY
ACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSH
PAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPSMTPASNTQSPQSSFPTAQQTV
FTIHPSHVQTAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSA
LQPIPVSTTAHFPYMTHPSVQAHHQQQL
Download sequence
Identical sequences ENSDNOP00000012175 9361.ENSDNOP00000012175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]