SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013677 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013677
Domain Number 1 Region: 468-601
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-37
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 3 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 95-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000118
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000013677
Domain Number - Region: 155-226
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0706
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013677   Gene: ENSDNOG00000017635   Transcript: ENSDNOT00000017634
Sequence length 604
Comment pep:novel genescaffold:dasNov2:GeneScaffold_6819:38226:192317:1 gene:ENSDNOG00000017635 transcript:ENSDNOT00000017634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEVLAALAALACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIVSVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKNGK
CKKA
Download sequence
Identical sequences 9361.ENSDNOP00000013677 ENSDNOP00000013677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]