SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013988 from Dasypus novemcinctus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000013988
Domain Number - Region: 14-102
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.011
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013988   Gene: ENSDNOG00000018030   Transcript: ENSDNOT00000018030
Sequence length 117
Comment pep:novel scaffold:dasNov2:scaffold_38024:7494:9615:-1 gene:ENSDNOG00000018030 transcript:ENSDNOT00000018030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCPPHVRRKKKTGSQARQPPKQQPPPPQQQNGTKGPETPGHTYEQVLEHPKSQDRRSPGL
WPEESNLYYADIQVCSRTQPRSVRGMKHLRSENTTEYATLRFPRATPHYDSKNGTLV
Download sequence
Identical sequences ENSDNOP00000013988 9361.ENSDNOP00000013988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]